Products

CCL2 (C-C motif chemokine ligand 2), Mouse

CCL2, also known as MCP-1, is belonging to the CC ß chemokine family. CCL2 can be identified in endothelial cells, smooth muscle cells and monocytes as the results of reaction to several atherogenic stimulants, such as CD40 ligand, (IL-1β) and oxidized low density lipoprotein , interleukin-1βplatelet derived growth factor (PDGF). Recent study shows that in vivo MCP1 have several critical roles in atherosclerosis. Additionally, MCP-1 has been proved involving in monocytic infiltration of tissues during several inflammatory diseases, and has been implicated in macrophage-mediated tumor growth inhibition in mice. In addition, CCL2 has been shown to have direct effects on tumor cells in an autocrine and paracrine fashion in multiple cancers, including sarcoma, lung, cervix, ovary, breast, and prostate.
No. Size Price Qty Status
C02084-5UG 5 ug $108.00 Inquiry
C02084-20UG 20 ug $268.00 Inquiry
C02084-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence: 
QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLN
VKLTRKSEANASTTFSTTTSSTSVGVTSVTVN with polyhistidine tag at the N-terminus

UnitProt ID:
P10148
 
Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to chemoattract BaF3 cells transfected with CCR2A. The ED50 for this effect is <8 ng/mL.
 
Purity:
>98% as determined by SDS-PAGE analysis.

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage​:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping Conditions:
Blue ice
Reviews for CCL2 (C-C motif chemokine ligand 2), Mouse

Average Rating: 0 (0 Reviews )